PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn280481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 106aa    MW: 11662.3 Da    PI: 6.7162
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn280481genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.81.8e-26148451
     G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                +rWt++LH++F++av+ LGG+ +AtPk++lelm+vk+Ltl+hvkSHLQ
  Achn280481  1 MRWTSTLHAHFIHAVQLLGGHGRATPKSVLELMNVKDLTLAHVKSHLQ 48
                79********************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-12148IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-20149IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.1E-22148IPR009057Homeodomain-like
PfamPF002494.9E-6148IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MRWTSTLHAH FIHAVQLLGG HGRATPKSVL ELMNVKDLTL AHVKSHLQVD GHDVALHVLD  60
TENEKLDSST LSSSDVFLNL DFTLGRPNCQ MDYPKSSNDL SLLKC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525638.11e-30PREDICTED: probable transcription factor KAN4
TrEMBLA0A0D2SEB12e-28A0A0D2SEB1_G
TrEMBLV7CV737e-28V7CV73_PHAVU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA122621822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.22e-28G2-like family protein